SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT08965 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08965
Domain Number 1 Region: 459-548
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-19
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-18
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 676-776
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000196
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT08965
Sequence length 780
Comment pep:novel supercontig:GCA_000347335.1:Scaffold66549:30235:36293:1 gene:F775_06344 transcript:EMT08965 description:"Putative B3 domain-containing protein "
Sequence
MCYVLQIMYADSNNVAEYEALLHGLCMFLIDRVAQDLTVHAHHILSLGNVSVDSKTHMVA
SSISRLVGSEGSARVPRFPLARIPGSPVDSLKCQIFAADGFSLTVQCMSSGKMGCERCER
RDELDYCNLDDREKHFLMFIVDDCGQEMIVPDEFLRRFRGEIPTEIKLETRNGHSYTIGV
AKYPDKLVLQAGWGTFVKTYDLHMDDCVVFRYKGNSQFDVIVFDRFGREKPFSVIRDNAP
PVQESHNSGTENLDRSHGHSQPMEVQSPIATANHSDRRPQPMRMQPPTENANPSHAHPQP
MRMQPPTENLDDPVGFSPPTENVNNLFGHSQPTQMQPSTEAVDHFVQMQPSTEAVDHSNG
HAQTMQMQPSSEVVDHSNGHAQTMQMQLFCRPTKLRQTKLQWDYSSMGNKTATSPSGDSL
SSEHDIEGCASPRYTLIHNASLNTVQKEEVDEKVKSIHEDNPIFVAVMRRFNVTGTCTLT
FSKKYVQTHVGDKERRVCLQRFGKRWDVQFSSSREVKRIVSGWRKFVKDNDVETGDICIF
ELLKIDEMCTMEVHIIHAKDFGRPSQIGGRSVEGRCKEATTKTVEPSHSRPQLVQMQLRN
ASVEDSYSRPQPMEMQSPSKERKIRVETVNSSPGNEGDSSMSEDSVTLTGCIGVHLRRIP
LIQKKVVKQKVDLIGSEIPICVLVMQKTNVTGRFSLSISKRYVRRYLGDEVRSIWLERDG
ERCQVTLGRGPQNNRVVGGWVKFAKENGLRPGDVCLLERLRHCKECTMKVHIVRRVKRAC
Download sequence
Identical sequences M8B5T2
EMT08965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]