SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT09336 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT09336
Domain Number 1 Region: 52-121
Classification Level Classification E-value
Superfamily PapD-like 0.00000000131
Family MSP-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT09336
Sequence length 200
Comment pep:novel supercontig:GCA_000347335.1:Scaffold64622:13740:15106:1 gene:F775_10795 transcript:EMT09336 description:"Uncharacterized protein "
Sequence
MSSTLLRVCPSELKIPCEDDEPEEVLGAPHLRHSAAPELLQRHSAGHGVGLVTMQAPRDM
QLDHHCKDKFLVQSAVARDGATMRDLVPELFTRAPGRLIEEFKLRVVYIAANPPSPVPEE
AEEEDASPRSEVTMGYEAKVSSAFDAASRCMDNSGAKPSCTKGASVVPTLVGEKVSTREE
NQKRLQQNMMVFSYGTSNTY
Download sequence
Identical sequences M8B5T8
EMT09336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]