SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT09479 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT09479
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-36
Family Protein kinases, catalytic subunit 0.00086
Further Details:      
 
Weak hits

Sequence:  EMT09479
Domain Number - Region: 208-309
Classification Level Classification E-value
Superfamily PapD-like 0.000191
Family MSP-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT09479
Sequence length 309
Comment pep:novel supercontig:GCA_000347335.1:Scaffold63984:42364:44067:-1 gene:F775_17546 transcript:EMT09479 description:"Cysteine-rich receptor-like protein kinase 40 "
Sequence
MSGHDDVQFDKEFYNLVNLQHQNIVQLVGYCHETRREYLPYNKTKVLAEVTKRALCFEFV
ENGSLNSYLFDESKGHGWRTRYAIIKGICNGLKYLHEELKPPIFHLDLKPANILLDKNMI
PKIADFGLSRFFKEEKSHSTNSPIGTLLGVVVIKIIAGPPGHCRSAEMSSEQFIKIKRPT
IGDIVNMLSETETLENDQGALIDQMSTCMVKDTELIDVHPLQLHFSFRPNKIISCPFHVT
NNTDDQHVSVRCVPRLPGADRYYAYLGHVCSVVPPRSTHTIVVTMRQLQQPPDNMDMLDI
VVETIPGKD
Download sequence
Identical sequences M8BRR7
EMT09479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]