SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT09780 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT09780
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.33e-23
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 237-341
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000314
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT09780
Sequence length 352
Comment pep:novel supercontig:GCA_000347335.1:Scaffold62642:11699:13141:-1 gene:F775_22542 transcript:EMT09780 description:"B3 domain-containing protein "
Sequence
MQKMGKNCERCAEWQEHCYWSHMADEKKHFFKLMVGDFTESMSLPGRFAKNFNGHISEVI
NLKPPTGKSWSIKVAGDTDEVVLRSGWKEFVDGHGIGEGDRLLFKYSGASSFDVLMFDST
GCQKPPPPRPVKRRGCDDDITENSARAKGRRCGYQASNKTEERAPHPPPAAKGDGAGLEL
TLYRGTGKSIARAGLEMDHGEAAAKNRYYFCKNGPVSEFHLTEEDKEEISSIPVPVEPRN
PVFVNVMHVSHVRGTTRTSIVGVSSEFAGKYLGAIGREIVLRRAGRKGGWHVRYISGDNC
RGFCGRGWRDFARHNGLLAHDICIFEFMEDARRPAANVHVLRRLHGRFVLVR
Download sequence
Identical sequences M8B837
EMT09780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]