SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT09781 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT09781
Domain Number 1 Region: 5-89
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-20
Family B3 DNA binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 203-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-19
Family B3 DNA binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT09781
Sequence length 306
Comment pep:novel supercontig:GCA_000347335.1:Scaffold62642:18854:20813:-1 gene:F775_23389 transcript:EMT09781 description:"Putative B3 domain-containing protein "
Sequence
MIGDFRDRMTIPDKFVQKFRGQITRTVKLESRNGNTFDVHVTEDLHKVVLQSGWEVFVSA
HGISMGDFLVFNYDGNSWFKVLIFDPSGCERLSSSCLPMKTAPHDGQECGEKLTGTLSMR
HDLPMMGSPQSERGTMIQWDNSNHVENSIVLGSSSAPSSDSSGDGLSLEDNQELSFVPSP
ILRNRANLTDIQERKMNEKVDAIHSKIPIYGTVMTKCNIFGSPCILDLSSKYADEYLPRE
DQTLMLQRRDKSWKVQFHINKNNTKRLFQGWGEFADDNNLKVGDLCLFEPLQKKNRVMNV
HIIRKA
Download sequence
Identical sequences A0A1D6RZP8 M8B746
EMT09781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]