SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT10769 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT10769
Domain Number 1 Region: 190-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-21
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT10769
Sequence length 820
Comment pep:novel supercontig:GCA_000347335.1:Scaffold58199:26693:35409:-1 gene:F775_32613 transcript:EMT10769 description:"B3 domain-containing protein "
Sequence
MLCLWPLPPAPFPLGEKFNFLALSILTISFPLLSGWRSSSLSSAIYSTKRSLVGGTVRFV
GSGGVQCVNCMKNPGPQPVPCQVAPKLFLPPQNNQRLFGKSDEFLPGRPLESPSLMLDSR
NDDIAIIAKSNHPFMHAQRARHFLTRPPRVAEGAAFDPMRDGFPHLRVARPPAEGRGRNQ
LLPRSNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGRPLTIQDAKGKEW
HFQFRFWPNNNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIEPGGKLVMGFRKATNTVSLP
DSQISAIATGSLLGDSFFSNTNENLSIVSGYSGFLQSMKGAADLQPSSLFDHHANSADGD
VSWLKADRFGGRPDEGSFQFLHKRSRNIGSKSRRLLMDNEEALELKLSWEEAQELLRPAP
SAKPTIVMIEDYEFEEYDEPPVFAKRSIFTSRSTGEQDQWIQCDDCSKWRRVPLNVIIAS
KWRCADNTWDPKSCSCSAPEELAHKELQSILQQYEEIRRRKSNYFLKQSIPEMDASSLDA
LATAAVFGEVGNQGAASVATTTKHPRHRPGCTCIVCIQPPSGKGPKHNPACTCNVCMTVR
RRFKTLMMRKKQRQSEREEAEASKRIAWVGRDEPEGSNLSRSPRTVDTTRDCDVIMFDKA
DANKGHIDLNFHPASREEEQQHGGQPRVSMVSLLEVANRPLESYMKQNGLGSDFINGHHR
DACGENFKSSILSGPGLRVMKPHLRKSAQIDSVTGPVEMTVLTFLPRSTFQPNNILKNEP
QEYSGAKLKPFQAISLETMTIRRRGGREADPLAGRSSVDP
Download sequence
Identical sequences M8BVH1
EMT10769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]