SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT10909 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT10909
Domain Number 1 Region: 1426-1608
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-37
Family WD40-repeat 0.00073
Further Details:      
 
Domain Number 2 Region: 385-656
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-28
Family G proteins 0.063
Further Details:      
 
Domain Number 3 Region: 755-1073
Classification Level Classification E-value
Superfamily RNI-like 1.8e-23
Family Cyclin A/CDK2-associated p19, Skp2 0.05
Further Details:      
 
Domain Number 4 Region: 191-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000638
Family Tandem AAA-ATPase domain 0.07
Further Details:      
 
Domain Number 5 Region: 1257-1393
Classification Level Classification E-value
Superfamily PapD-like 0.000000942
Family MSP-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT10909
Sequence length 1613
Comment pep:novel supercontig:GCA_000347335.1:Scaffold57601:20709:28710:1 gene:F775_10845 transcript:EMT10909 description:"Coatomer subunit beta'-2 "
Sequence
MADLVVGMAKSVVDGALTKAQAAIEEDTKLRQSAQRNLVFITGEFQMMKSFLNIADSERL
KNPVVRTWVLQIRELAYDVEDCIEFVVHLDKKNRWWLRVLKPASWFLRPCVDLSRLLSLD
LAVVELEQLKARVEDVSSRNARYSLINSDSVSKPATTAAQPASGDTVGMMAVNRLIQAAN
TDREELNITRLLPKKDHDLGVISIWGTGVGDLGMPSIAWNTYTDKETCKNFVWRAWVKLT
HPFDPQEFIHSLTAQFHANSCKEEPASSPGGRKKMEDDFKQLLTENRYLVVLEDLSTVAE
WAAIKRFFPKEKNGSCIILSTQQFEVASLSVGHPYQVLHLNQLSAADHSVYAFFTEESQY
DGDRGMTSQTGQAGNSCKRAAANRWIYEHPLVGRELDMKDLDRNVITTRGRSYQVMSVWG
FTGVGKSALVMNTYCKEILKGDFQKYAWVDVSHPFNLWDFSRTLLSSFGSRKLQDSEHTH
LYSMGSQNPIPQCREILTQQTCLVIIDGLQSTIEWDLIKAELVSGSNRRNVIIIVTTEQE
IATYCRGDKGHLVLNVKGLEADTAVELFEKVSKKGKVAEIGELTSICGGLPKVIVEIAGS
FAKNTDRWKDALSNNKKFMLELENNGEFLSLRGLLDWMNSSFRNYADSLKSCILYLPVFP
RNHLIRRRRLVRRWIAEGYSRDNHEESAEMVGEEHFNDLVDLRIIQQSSLLGMDDTRMDF
CQVNGFFREYIVSHQMEGNLVLELRGNCVLTSQRTGRHLAISENWVRDRIVFESIDFSRL
RSLTVFGKWKSFFIYQGMKLLRVLDLEDASEVEHSDLKKMVKFMCRLKFLSLRGHHEIKH
LPSSIGDLRQLESLDVRHTSILTLPESIIKLQKLQYIRAGTKAPSRKTPTPHHLLSQLSS
YCSGRQPVGVVVPPGIGKLTALHTLGVINVRASGTKAVLEDAKKLTHLRKLGVSGINKNN
SNKFFLAISDILQLESLSVQIEDNNESCLNGTALPLESLRSLKLYGLGDRLPDWRAQLTK
LTKMDLEIAKLTEDHVSMQPEGRREHTSGVIKFLSELPGLCILRLRVHHLQDNQLDVSII
YNDLELDSFEKLKIFEIACSFSSKVTFGEKTMKKLEQLKFECCSGSTFFGLEYLAELKEV
LLKGARDEQLMSEINAKLENHPKDSHRAKLSFASSTSNPVLQVPQCNQDKDNDIINGVVA
YQKVSQASGRLLEQSNKGVGRVPGMWGRPRAQPPLRFGTPPETFPPETETSLIPQIDSEL
LLHVHPLELTFMLSISLEVLRKKKAASMSSSCSLHLDNKGNDRVVFLLVANSPSRYLAKD
PLCGVVPPRCIYTLTLTMCNNKQQALSMPSIDSGADYFTLHSVVVGQYELDKDTISAEYE
EFFKKTKEEAGHEVQEVALNVICCQQQADCGTSSDSEIITKADALEVSSMDVHPIEPWIM
TTHRVGSLRVWNYKTMKWIVAGDRNGCIHVHNYEENEEVESFCAHSSCITTLAVHPTDPF
VFSSSNDAGHLIKLWNWDNDWECKEFHGHVGTVTQVTFNPNDSNSFASASKDGTVKIWKL
ETKERVHELESHTNLISAANLHPELPILITGSFDGTVRIWNSITYKYVLLQFF
Download sequence
Identical sequences M8BVT9
EMT10909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]