SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT11274 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT11274
Domain Number 1 Region: 134-425
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-70
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 781-1054
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-66
Family G proteins 0.091
Further Details:      
 
Domain Number 3 Region: 1113-1141,1186-1313,1380-1554
Classification Level Classification E-value
Superfamily L domain-like 9.01e-35
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 4 Region: 435-561
Classification Level Classification E-value
Superfamily PapD-like 7.59e-17
Family MSP-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT11274
Sequence length 1572
Comment pep:novel supercontig:GCA_000347335.1:Scaffold55992:3806:11562:1 gene:F775_00089 transcript:EMT11274 description:"Putative disease resistance protein RGA4 "
Sequence
MYPTADEAVRVYNVAAWRVGRLRTELNFPETETRADAEVLVPDNFRMEEMTKEKKKKKKK
PTIVIARLSIRSISRPSAGSTGNATPSRRRRGLGLNLGSRASSLQPIWSQLSQLRMGDET
LLERILNGDEEPKDLPLGLLQSITNDFSEERKIGQGGFGAVYKGVLRNGIIVAVKRIYVT
AHTIDDKLFRREFNSLRKINHQNVVRFLGFCSNTYQTPIQEAGSEEINLANVRERLLCFE
YISNGSLDKHITDELRGLEWETRYEIIIGICKGLRYLHEETSIVHMDLKPENILLDGTYL
IPKFTDFGLSRPNKNTHTMGLRFGTRGYIAPEYENSGKASVKSDIYSLGAIIFELVTGCM
GIPDENNVLRRWRHRWTKPPTLLQYQQVTRCLNIAVRCREQNPEARPSILKIISFLSESG
STDMHTSQIRPCYIEDDMLGIKPLELLVPFELKKISCFTIELINDTHSCIAFNIKPSNPP
WYRAQPDKGIVRQQCKYGVKITVPPQDMHHADKFIVKSMKVSEGLTDEDIIEHTFEEAGK
IADEVNLMVVYEPHENSKSREETNKPVEEVPKVERRKIDVSASGKSKLGNGGNAEAASMA
IKSRVQGQCIKQREQRRFYPRQSSSHHSLGYMLIPLLDRVAVKAGDAQVAKLLRACGLGK
ARQKLECHLADIQCILLDADTKSRTNAAVHSWMEDLKTVAYQTDDILDDFRYEALRRHAA
KIGHVSTAHKVLSYTTSNNPVILRHSMSKKMKDTVDMIDELVEKMNSFHFRQHTEAPRID
HLQTHSQVDKSQIVGRQDEKEQLVKILLGHCYNKNNSNHVMVLPIIGMGGIGKTTLAQLV
HNDQRVKHHFELVLWACISEKFVIEEIVRSVIEVATMKKCDLTQMEALQKELCGVLGKKR
YLLVLDDVWNEDGHKWDAMRSLLNSHAGSGSAIIVTSRSDQVASIMGTLPPHHISLLNED
QSWELFHRNAFGREAEKQDELITVAKKIVHKCKGLPLAIKTIAALLRSKHHSQWFSVLDS
DVWKDDILTSAIVPALQLSYDHLSSEAKICFSFCALFPKDSPMDKDTLIQLWIANDFIAS
ETRGQEIFDILVWRCFLQDVENQHYTKIGDYEHIHRSIICRMHDLMHDLAESVSGNDCFI
LQESSSCQEILHGPTNIGSLQHEVQYLSLDHVSNNTLAAMKEMLAPRARTILCVQRELQW
TQASLDKGKSLIMALSKFMSLRALRTLSFETQMANLKHLRYLDLSYSGIATLPGSTTMLY
NLQTLKLIGCEDLKKLPEGMRYMSSLRHIFLAGCPNLDCMPQGVGQLNSLQTLTNYIIDS
DAGRGIDQLKDLNLGGSLSLTQLRKVHSAENAKQGNISAKHNLKRISLSWYGLCSRAGYE
VDTNAEGILEALCPHNGLEVLQLSNYSGAKLSSWMHKSTLLEHLRELHLRSCRKCKDLPP
LWQLPSLWYLNLDNLDSVTSMCVGNDDTDNGESCIPPSPIFPKLRVMIVYKMPKLERWHQ
VARQVSAVSFPRLKVLHISGCPSLETLPEGLLQQVSALTELDMRYCDKLKGAFSRGGAYW
KLVEAIPMRTVF
Download sequence
Identical sequences M8BWU5
EMT11274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]