SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT11594 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT11594
Domain Number 1 Region: 8-64
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000331
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Weak hits

Sequence:  EMT11594
Domain Number - Region: 420-448
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00161
Family B3 DNA binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT11594
Sequence length 453
Comment pep:novel supercontig:GCA_000347335.1:Scaffold54671:17324:22459:1 gene:F775_32926 transcript:EMT11594 description:"Polycomb group RING finger protein 3 "
Sequence
MVKRELLARCMTCPLCNRLLRDATTVSECLHTFCRKCIYKKFNDEEVESCPVCDIDLGCT
PVEKLRADHSLQDVRSKIFPFKRKKIKAEDVASPDSPPNKRKERSISSLVVHTPRLTPTG
STGRRTKVVTRKAAAALHSLGPTIDSPVKKENSDKSAHSSSFPANLGKVPKTKRQILSNA
EEASNYSSNKDTEDDSKDMADNAELWRPLNCLVEAANRTKSFRSSLQGSGVKREQLNGSP
SSTNGIQTNPKEHPKRPKTEDDKKDAPVSPVTLKRKLKGTGRRRSGLRAPADGDPDGALT
QNEKRFNCIWFSLVASLEQRSNNSHRKGDSPLPQIPSHYLRIKDANIPASSIQKYLVQKL
SLPSESEVEINCCGQPVNPTQPLRNLVELWLRGRSAQATPAIVGSPAEEFVMAALLLLRV
LNFEDGTGKVWRFRYSSWNNSQSYVLTKAGAAS
Download sequence
Identical sequences M8BXM9
EMT11594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]