SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT11662 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT11662
Domain Number 1 Region: 45-138
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-18
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 240-349
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000177
Family B3 DNA binding domain 0.013
Further Details:      
 
Domain Number 3 Region: 468-561
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000011
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT11662
Sequence length 561
Comment pep:novel supercontig:GCA_000347335.1:Scaffold54420:14517:17145:1 gene:F775_00097 transcript:EMT11662 description:"B3 domain-containing protein "
Sequence
MVRQTVHLCSSCTAGSRGDKVEAPGDAGISKMHNPCECCQIKLKFLRQINGNFMHSLVIP
EWFVNQFGGKICGTVRLETSDGNMYDVGVTESMNRTILKSGWSSFVDANQIEENYSLMFR
YLGNARFEVTIFDSNGKENTWCCSGMRNASGVHKPSSFDVDNSSSRGGTTQSSASEGSDS
DGSQKERSYSSEESSAEYNLSIDNPVESDDVRNYYVLSGKCDLTEAQELKLHAFVQKIRP
EIPMLVVLMKKSNVRHHGDLVIRKDYAHKYLPCKDTNIILQLPRKNKIWECKFQIRPSGS
TDAGRRNLSLGDFVGDNLVREGDICLFEPMTNTKQKRFTMTVHILGKLSIDHSPGRTTDI
GSNHGRRCTKMGGVKTKPPINGEEYSSQHEECGVSDNSEECSEPPFMLPHRSCLTTAQEN
KVLEKINDIGSDSELPFYVAIMGKINVCRDSSHYINPPILNFGFRYAARYLRKKFTAGHH
GGKCNAINLVLQREGKSRPWPTKLRYTHIMRASSQQMRVIKGWPSFARDNRLREGGLCLF
KLMENEEQLTMMVYIIRREKC
Download sequence
Identical sequences M8B4K3
EMT11662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]