SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT12157 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT12157
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily Mannose-binding lectins 3.27e-38
Family Mannose-binding lectins 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT12157
Sequence length 184
Comment pep:novel supercontig:GCA_000347335.1:Scaffold52328:116725:117440:-1 gene:F775_02802 transcript:EMT12157 description:"Uncharacterized protein "
Sequence
MGQGQSPSPVVKLGAWGSDAGAAHDIDVTAAAPHRLESIVVRWGKVIDSVAFTYTDEGGQ
LHTAGPWGGAGGVEEDTITLGPSEYIAQVAWSVGPFQFKEIEDCVTSLKFVTNRGATYGP
FGRGDGAHHSLPVLDGGSLVGMFCRAGDYLHAIGFHVRPLAVVESTASPAKPQGESLPAV
ATEG
Download sequence
Identical sequences M8B5Y2
EMT12157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]