SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT12158 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT12158
Domain Number 1 Region: 25-175
Classification Level Classification E-value
Superfamily Mannose-binding lectins 8.37e-39
Family Mannose-binding lectins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT12158
Sequence length 194
Comment pep:novel supercontig:GCA_000347335.1:Scaffold52328:119738:120429:-1 gene:F775_16170 transcript:EMT12158 description:"Uncharacterized protein "
Sequence
MPCYLLHIRGLMAGARCVQVQGQSPVVKLGAWGSDGGAAHDIDVGVAPPHRLQSIALRWG
KVIDSLAFTYTDKDGQPHAAGPWGGAGGVSEDLITLGPSEYVTEVGWTVGPFKLKEIEAC
VTSLKFVTNLGTTHGPFGNGDGAHHSLPVLDAGSVVGMFCRAEDYLHAIGFYVRPLAVTE
STDSPAKPEGESLP
Download sequence
Identical sequences M8CAK6
EMT12158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]