SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT12201 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT12201
Domain Number 1 Region: 26-344
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.38e-73
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 319-419
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000000194
Family MSP-like 0.011
Further Details:      
 
Weak hits

Sequence:  EMT12201
Domain Number - Region: 473-501
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000352
Family WD40-repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT12201
Sequence length 516
Comment pep:novel supercontig:GCA_000347335.1:Scaffold52201:70415:74370:1 gene:F775_05086 transcript:EMT12201 description:"Putative cysteine-rich receptor-like protein kinase 23 "
Sequence
MGDEDSAYYLLESRLRDPSADPTDLPLSLFKSITNNFSDKEVIGSGGFGVVYKGVLPSGI
FVAVKKLSDALVEDKLFQDEVACLIRAKHRNIVRLLGYCADTQGKITEYKGELIMAKVRA
RLLCFEYVSGGSLDMHLEDEFCGLEWHQRYIIIKGICHGLRHLHEEQKIIHMDLKPQNIL
MDPNMVPKITDFGLSRLIGIQQSRIITMNNFGTLGYMAPEYSHHGTIKFKSDIYSLGVIL
LELITGTRMPPNIENVHKNWKNRLQETLSYSSVEASYKQVKRCVQVALNCMETDSEKRPS
IGEIVKILNEIETGYEEDETPTSTQLLCIHPLELRFPFKPNHSITCPLHLTNNTDHRVAF
RLQPERLERYFTEWLCGVAPPRSTYTLIVTMRDRQQSLPATDEFLIEQSRLRGETELKDI
SQGKAETEYDNFFTEVKEKGVDPVLEQTLTAVCDPEGNITAEIISTVDFDKMVSMDVHPT
KPWIITSHFNGHICIWNYQTKSSCTGELEWKTDYVY
Download sequence
Identical sequences M8BE10
EMT12201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]