SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT12525 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT12525
Domain Number 1 Region: 230-332
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000412
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT12525
Sequence length 340
Comment pep:novel supercontig:GCA_000347335.1:Scaffold50948:7184:8583:1 gene:F775_29329 transcript:EMT12525 description:"B3 domain-containing protein "
Sequence
MAAGDVATVFLEMSLGTRLAVSFPAASTTVADLKRRVSHEHAACFPNYGQIAVQSVKVEQ
GGSWFHLADSMAVRDAFQFHGANETWHLQVDALPHPQHLGQGMATEGHSKDSSAAHSEPS
CEMLADQVKVEVGADSEPSCEMLTDQVKVEVGAEEPLSAKGKRSSNGTDPKGSKEAEATS
TEQGACERKRLRPRIRVGKTPITKAANSSGSSESEEMDVNTVGVDAPPSQFVVMLKECHF
VTKNGQYLNVPREFSVAHGYAERKKVLLRMGGESWTVNLKHAHNVRGKARTSFRYGWHQF
CVDNHLRVGETCFFRALGQGGGDRHVLKVEVRRLDGSYAS
Download sequence
Identical sequences M8BFM2
EMT12525 XP_020186935.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]