SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT12716 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT12716
Domain Number 1 Region: 129-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-21
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT12716
Sequence length 248
Comment pep:novel supercontig:GCA_000347335.1:Scaffold50093:25073:26816:-1 gene:F775_09361 transcript:EMT12716 description:""
Sequence
MCVEKPSALHAKPSKDFKEESDEDDNGVAPQEENNGTTKKPTGEIYADGSTLKKCSNASV
KATRQKRNKNAADPSESLEVAGACRSARTSIKSNDAVMKVQRQHAIVSQRLPVSEGQKKY
ALQRAEIFTSKYPSTLQVIKAASAYNSFFMVIPSEFVREHLPHTSKKLTLWDPQATPWQV
DYVYCSHRSAGAFSRGWSQFSIGNNLEKFDVCVFELIAEDTIKVHIYRAQLLIAQYQHQE
ELSAAIPN
Download sequence
Identical sequences R7W1L7
EMT12716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]