SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13106 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13106
Domain Number 1 Region: 131-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-24
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT13106
Sequence length 233
Comment pep:novel supercontig:GCA_000347335.1:Scaffold48884:22212:23797:1 gene:F775_06135 transcript:EMT13106 description:"B3 domain-containing protein "
Sequence
MAGAIAYEEQRRRQVEENKRKLEELKLHHLSAAVREAATPKPSPTKSLKRKRVPREAGED
TPIRRSGRVASLPEQPKYRFEDVFHVLEKKIRRGRRTTTSTRSDLINRVYATDKAREYAT
TMAEELQAKLGSGYPSFVKPMTQSHVTGGFWLGLPLPFCRKHLPKRDERLTLKDEQGVES
ETLYLALKNGLSAGWRGFAIQHNLVDGDCLVFELINRTTFKVYIIRQSSYYER
Download sequence
Identical sequences N1R2B2 W5I9K8
Traes_7DS_A234A13E1.2 XP_020160679.1.58150 EMT13106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]