SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT13191 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13191
Domain Number 1 Region: 21-184
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.48e-28
Family Protein kinases, catalytic subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT13191
Sequence length 199
Comment pep:novel supercontig:GCA_000347335.1:Scaffold48597:88741:90088:-1 gene:F775_24201 transcript:EMT13191 description:"Putative serine/threonine-protein kinase "
Sequence
MDSEACTSHVDLLERLLLDESAEPTNLPLSLLQGITNCFSSDHEIGRGGFAVVYKGVVGK
GIVAVKKLTNTFAVPEIKFHEEARNLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQ
RNWLLCFECLTQAQTYVITKNIVGTMGYTDPEYIRSGLIGFSSDVYSLGVIIMEILTGVR
HNRKDEHVRTSRRFPQVEL
Download sequence
Identical sequences N1R2D0
EMT13191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]