SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13199 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13199
Domain Number 1 Region: 474-566
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000049
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 1009-1096
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000131
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT13199
Sequence length 1101
Comment pep:novel supercontig:GCA_000347335.1:Scaffold48577:6240:12634:-1 gene:F775_02758 transcript:EMT13199 description:""
Sequence
MRESHHHHRHHAVVLTKLSLAPLLDQEFEGRHRAERVLNSELLEGSEHALDTLYVATAGP
MSYQQSRTRAGVVLVPKPSVPHFGVDGVPEVVVQVVRQEAASAVDLLAVGTAAHWGRRDR
HSIRGQMPVIGQEAAGPEWEHGLTGRRFPIKKDGDRLPGRMTGGADCACPINLNGGRRRE
RMSSGELARQDRSRSRDTEMECEEEEEEEDETCKMLSEEEEQEVEMWDKKVQSRKASTGS
LEKGRRMEEPIELSDDADDNETIMEMSKKAAKHKEKKRRHNDDGDHKKKKKKSVSSHGGD
KNTHSADRDKDMRRDMLLSPNKNKGPFHSKEKSWKMPSSHGGDRKMHRGGHHNDNKSSMM
WRSEYDKYKGMKKKEMNKDKKPWPVHNGGSREEKKKTALFLSKEGKMPMLDDSSNKGNKR
KKMPMMYDKVKKPRTSDKDDKAGSYDRKKTTLGYNAGQKVQSGHGEEKKVKFAFFKVAGE
HFEEFLLIPPKPAGAPKMVGLTNQLVCLEDSEGKSSMVRLSVVDGSLAFYQGWSNFVSDH
SIKWAEIILFEYTGCSKFSVRVFGADSWERVSFIVETRGEEKKQKESYAPDDLVPCRCSR
DINGHHYVSGEYIGSNRTKTKSDGYTDNAEVSPSNLVAKSMSAVPGTCRMSANSTQDPNG
VVGGIVCGSSVAPDNKDGHLANRKHTANAIFPSYIKDTTRSPEIIVMADEAPLAQENKDT
VALDNKKENLSIGECKTKCNASVTCNNEKTTRLELVPVTTDAAPLSQENGDAVELTTFVG
HIEDSVMMKESTSAKCAEIHGSDEDLRRKQEGNTVRLECTAAVDKFPSNNKMDTNGNACS
KYEYPGSFQCLEKWKGATVSGREALDGTGLIRPEKRLKTEEKLVGAMGVNPVERGYDGTH
SCVPSQISESGLTRTKIEHSVNGKGATGKPETKIEQVGTVESIGCRQERNNISISANRAV
ARQTEHHFFRKEDTKSSNPAPPVPLLPVKVEVSELDDHRPVLKANLQFVVPSTAQTRLEL
PDPLSNAVGRKGRLDQNIVMLKDPMKRLWPVFYHETSLFVGFTGGWKSFVAANKLEAGDL
CVLLMDLDEDELVYDVEITRK
Download sequence
Identical sequences R7W7F7
EMT13199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]