SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13220 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13220
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-22
Family B3 DNA binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 262-335
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-17
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT13220
Sequence length 336
Comment pep:novel supercontig:GCA_000347335.1:Scaffold48545:2126:4331:1 gene:F775_23801 transcript:EMT13220 description:""
Sequence
MASDSNRKAPCGKPQFLKVLFTDFMEKMPIPAKFMRRHLAAEPGLRRATLMSPLGKFWHV
DVVRDGHGGDSDVYFAGGWAEFVRANRLEEENFLVFKYEGNMVFTVKVFETSGCIKNYDD
LVVAGALLEQAAPRKRSSTGCGSQPTSKGHGGSHAQKTRKVSDRSLTGDGAIQAKKQYKP
RRILMEDNDGEQDATTEKYAQADTHSGIATEAKESDYTGTLPFYAKTATPCNIRYSYMAS
SLACSKSNIYSLVQIDMHCELIKFCVMNGIATNRLMILKDSGGRSWPVKLTLTSDQARMK
AGWGHFSGHHGIKVGDLCVFHLVDEHTFNVSIRRAE
Download sequence
Identical sequences R7W670
EMT13220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]