SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13764 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13764
Domain Number 1 Region: 36-154
Classification Level Classification E-value
Superfamily PapD-like 2.22e-27
Family MSP-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT13764
Sequence length 209
Comment pep:novel supercontig:GCA_000347335.1:Scaffold46679:49785:53885:-1 gene:F775_05285 transcript:EMT13764 description:"Uncharacterized protein "
Sequence
MAISGDDSGNLWVAEEVTILWRDLPSEFLDLVAGDEPGKQVKSAIRIKNTSKSHVAFKFQ
TTAPKSCFMRPPGAILAPGETIIATVFKFVEHPENNENILQKCKVKFKILSLKVKGPMEY
APELFDEQKDQAVVEKILRVVFLDVQNPGPQLEKLNTQLAEAEAALEARKKPPEENGPKI
VGEGLVIDEWKERRERYLAQQQVEAVDSV
Download sequence
Identical sequences N1QVT0
EMT13764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]