SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT13966 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13966
Domain Number 1 Region: 52-357
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-60
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 537-697
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.55e-26
Family WD40-repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 1053-1313,1487-1583
Classification Level Classification E-value
Superfamily L domain-like 1.58e-23
Family Internalin LRR domain 0.039
Further Details:      
 
Domain Number 4 Region: 369-505
Classification Level Classification E-value
Superfamily PapD-like 0.000000256
Family MSP-like 0.024
Further Details:      
 
Weak hits

Sequence:  EMT13966
Domain Number - Region: 737-941
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0239
Family Extended AAA-ATPase domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT13966
Sequence length 1605
Comment pep:novel supercontig:GCA_000347335.1:Scaffold46003:48612:60963:1 gene:F775_06422 transcript:EMT13966 description:"Cysteine-rich receptor-like protein kinase 41 "
Sequence
MERPPHSASSSGTPHGTKRYTVGFQFSEDDGESTLPSDLSSITISSGPSSAENFPSVEPR
VMPWSLLKEMTDDFSAARLVGKGAHGQVYKGVDKDGHAIAVKMLHGFHFDMEIEQMISII
PKVHHPNIVQLIGYCHEIEQVVVEYEGKHVIAAEIHNGLCFEYLPNGSLATYITPDDEDS
GLDWQTRYRIIKGTCDGLKYLHEGLRSPIIHMSLNPSHILMDEKMTPKIAGFGSARLFGV
ENTNITMSPLGTMGYMPPEYIDKQVISKEFDIFSLGVIILKLMKGQKSYHEWDFMSPEKF
IELVAHEKWGERLQKTMDVTLVEGHFQQVKKCLEIAVRCVEYDRQKRPTIGEIVRMLNET
ETSLIPQIDSGLLLHVHPLELTFMLSISLEVPRKKKAASMSSSCSLHLDNKGNDRVAFLL
VANSPSRYLAKDPLCGVVPPRCIYTLTLTMCNNKQQALSMPSIDSGADYFTLHSVVVGQY
ELDKDTISAEYEEFFKKTKEEAGHEVQEVALNVICCQQQADCGTSSDSEIITKADALEVS
SMDVHPIEPWIMTTHRAGSLRVWNYKTMLWNWDNDWECKEFHGHVGTVTQVTFNPNDSNS
FASASKDGTVKIWSICSDDPSKIITLKLDEHGLCVDYFTRNNQQHLIVGCNDKTAQIWKL
ETKERVHELESHTNLISAANLHPELPILITGASCKLVHLEVPIDRWVRFLELLVSARPSL
KQLVIMPREMIGADSIEIAVGNIVPYLEDTSNTAHKAIYFDGTGGLAASAVLRAIAQDPP
PSLLKKFDKIIHVDCSRWKSRRALQRTITQELKLPRLIMDVIDRQDEEDDFRGIDEGLRA
EIGFVGREILRVLMGQKCLVVFHNGSDNTIELNDLGIPQPDQWFVFGSKVLWTFRGRLRL
NPGVSKKVDDSHLFLYDTFSLYGWNYLLELEAREIARYTDNLGETVEECCLYLLSLNCQG
GNIMDYNWATHASNYWVCDGIIQGGHGDEAWEAAAALHQHINIEDYSSNALPSFGHELET
PSKRWILVKDNPVVHPESTSFFLAAVASESDPPLRSLPDDMFHKSDKLRVLKLCRCTFSF
SSPPFRRCRSLRFLGLDSCQDQRPEEDEKQDMDFLKSLWVIDIHNTDWNLPSSPEIIKQM
ATNIREVHIKNGRFWHIIFALGQPQNLHKLRVIDPTCCSLETGLPSLSSSTSLKTLVLDG
CVGLEHVEGLPPSLESFSLDARPRKDDYKEAKISRISLAGCARLSEFTLRGSLPNLEELD
LSATRVKTLDLTTQVVQVQCLQQIILLGCMQLHAILWPKEGLPTLTVLHIDTSVCPVQTK
LHEVDVTIMDMSVKGQSYMKKKMGPGNSGKIMGPAQPKSLNPNTCSTYTDVSVDNIIIDH
DYNNAMKFQPSGCHVEIGKGVSNASVESVQAINAIIFAMNQSESLHVHDSSSITTVIPEH
MMTVDDLDWEHLKHCHVVRCPKMHTVFMTNYGGYPFTEIETFWAADLPMAHCIWSKGTTY
RGTETRCFAKLRSIHLYSCPRLAFVLPLLWGTQGLYLQNLESLHIVNCGDLKTVFPVHAG
LKERVLEFPSLKHIHLYELYKLEHICEVKMHAPKLERCAECAKDQ
Download sequence
Identical sequences N1QWH4
EMT13966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]