SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT14307 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT14307
Domain Number 1 Region: 107-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000667
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000165
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT14307
Sequence length 261
Comment pep:novel supercontig:GCA_000347335.1:Scaffold44978:20416:21689:-1 gene:F775_18300 transcript:EMT14307 description:"B3 domain-containing protein "
Sequence
MYLGRGWEQFTRAHDLRLRYFLVFTFDGDAVLTLKVFDVSMCQRHYKHDDDMSTVSSSDG
DSGNNNSSVGDSGSNNGSVGDSGSNSSSTAEMDAENGPASQFSPMLRKCNLNVSVDFQLA
HGYAERSKVELRMRGKSWPVHLKHNPNTGGRPRAWFRYGWHQFCVDNSLGEGDTCFFRAI
CQGSASTGGEDHLTQGGGEEAGRQIPGLRRGPPLHASAWLAGVTSFVAMHGHGFASSVPH
LLSTQLSSPVIRVLCMYHAVQ
Download sequence
Identical sequences N1QWS7
EMT14307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]