SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT14839 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT14839
Domain Number - Region: 51-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00345
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT14839
Sequence length 150
Comment pep:novel supercontig:GCA_000347335.1:Scaffold43437:93326:93849:1 gene:F775_01501 transcript:EMT14839 description:"Uncharacterized protein "
Sequence
MPSPDQAHRSLHRREASARSSPPRSSTPPAFRVRSPAQPRGFPEGRHTSHGKKHGGLPVV
VCNVHAGTKELQLTQWESSHVNIIKGEGYLDFITRCCFEEKDVVEIWAFKERHFQLFGVD
MCRASPLYVVLAKKEQRPAASSMGMAKCTM
Download sequence
Identical sequences N1R327
EMT14839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]