SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT15081 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15081
Domain Number 1 Region: 182-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000114
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT15081
Sequence length 305
Comment pep:novel supercontig:GCA_000347335.1:Scaffold42639:29172:31765:-1 gene:F775_24378 transcript:EMT15081 description:"Uncharacterized protein "
Sequence
MGLGAGVFGDWTMYNVNSTVVSVACGSSSSVRGNNNNGYHQSSRLCSPTAWPNNFMPPPT
SPYSVYPHGIQQQQGHQQAITYNANNNNHQQGFVSNFTVDPPLLPAQCFQPISPASNNRS
SPQYLDEARYAKRAKRRTQKRKNSEDPPEMGSENAMMLDENHNFSNQAQQFFTTRFNCKD
YHMIVWKELTNSDVGNIGRIVVPKRDAEANLPALLERDGLILKMEDMRLPVTWNFKFSHT
DDARYFPGTGLTTRAGCMSWKVLLVRGEKVTGQCPTLICPECKEQGRIYNKQCGFTRNLH
AKKRR
Download sequence
Identical sequences N1QXS5
EMT15081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]