SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT15116 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15116
Domain Number 1 Region: 82-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000141
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT15116
Sequence length 282
Comment pep:novel supercontig:GCA_000347335.1:Scaffold42538:41026:45157:-1 gene:F775_21818 transcript:EMT15116 description:""
Sequence
MGRAVPCRAGVLLNSTIRFHPPSVRKLGKLSVLFLSSLRGEKLCERSIIYITTMMDRTGV
NELDLNRVSLDPNHQVAGLRVILQKELRNSDISQLGRIVLPKKESEAYLPILTSKDGRSL
RMHDLLNAQLWTFKYSISTTMTQFIISVQILAKQQEQDVIRAKKAGDDLVASLPQFHEHI
SSILPIPEVDDYVSLIPPPADISAFVPQADENYEMFDGIFNSLPEIPVANVRYSDFFDPF
SDCMDMSNPGLNANNSANLASHFHDERTGLSLFPNPKSGPLM
Download sequence
Identical sequences R7W4C6
EMT15116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]