SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT15148 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT15148
Domain Number - Region: 135-190
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0153
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT15148
Sequence length 202
Comment pep:novel supercontig:GCA_000347335.1:Scaffold42462:78046:79624:1 gene:F775_52212 transcript:EMT15148 description:""
Sequence
MDGRQLAGVALGGWMAAACRSSTDAGALVPSPVGVAAEPIKAVPLAAAALKERAEPPGIT
PPAVNARQNGSRLPIDGVMRNLRPVLSHLDRRAANLVHVETPRPWLPKLPKVPGEKTKKR
RGREHDGLPVLVIERYAGIRELQLTRWESSGVCVIKGEGYMDFINNCGFSVGDVVEIWGF
EQKALRLFSVDIYQKGYQESPL
Download sequence
Identical sequences R7W557
EMT15148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]