SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT15610 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15610
Domain Number 1 Region: 381-665
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-69
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 870-1072,1392-1514
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.1e-46
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 
Domain Number 3 Region: 59-341
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.69e-17
Family Reverse transcriptase 0.035
Further Details:      
 
Domain Number 4 Region: 1147-1292
Classification Level Classification E-value
Superfamily PapD-like 0.0000000128
Family MSP-like 0.01
Further Details:      
 
Domain Number 5 Region: 1311-1425
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.000000471
Family Prolyl oligopeptidase, N-terminal domain 0.066
Further Details:      
 
Domain Number 6 Region: 719-795
Classification Level Classification E-value
Superfamily PapD-like 0.00000201
Family MSP-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT15610
Sequence length 1629
Comment pep:novel supercontig:GCA_000347335.1:Scaffold41008:59631:72756:1 gene:F775_09290 transcript:EMT15610 description:"Coatomer subunit beta'-2 "
Sequence
MLTRARAGIHRPSHRYSADEYLLAASTSAPSPLPSLARATLHDPHWLAVMQEEFDALHRN
RTWQLVPQRSHANVISDKWVFRHKIRPDGTLERYKARWVVRGFRQRACVDFTDTFATVVK
PGTICTVLQLAVSRTWPVHQMDVSNTFLHVHLAEQVYCQQPIGFVDATQPDHVCLLSRSL
YGLQQAPRACGTAYLLLYIDDIILTASSAELLCQLIAHLDTEFAIKDLGPLHHFLGIEVY
AQELLERAGLLNCKPVPTPIDTKAKVSALDGSSAQDAAFYRSIVGALQYLTLTRSDLQYA
VQQELHLGVAKATVVYCDNVSAVYLSANPVHHRRTKHIELDNHFVREQHSFFFKEDHELM
YTGRFRGHAFSNPSLVEDETADPKALPLSLLKDITNDFSNDRQIGRGGFAVVYKGVLESG
TVAVKRLSDMCMDEKKFHGEVQCLMKARHKNIVRFLGYCADTQGNMLSYNGKLVMADVRQ
RLLCFEYMSKGSLRDYISDESCGLEWRKRYQIINGICQGLNYLHENRIVHLDLKPENVLL
DDNMVPKITDFGLSRYFEERQTSQSITSNISGTLGYIAPELYDGEKITIQSDIYSLGIII
IEILTGRKGCPDVGVVLERWCERLGKSLEDTHVEQVRVCTEIGIECSDFNPAKRPVSTHK
IIERLKETETTDEVSQKELPLKFSNDSDDQLYPCKYAYMMNLRTIARVSSVLSSIVPTKL
FVHPHLLCFPCVPNKLIPSSLNLRNFTDEHFAFRLVESYAEETQRRFAKLPLYGVVSPRS
THTLSLTLQERDEKSIHLVLESSTFKDAHMPMYCSEFRGDKFLEETKEKGNMVQHVIVKA
VATTAQRELTSEDNNRPYTGICLHLGRSNTVVLVKFIVRKQWFVAGAGDGFIHIYNYETK
RQQVPSFTAHAGKLTSLAVHPSKPYLMSWSSDEMNLWDWDKAWECTQTFKCKHSGYICQV
MFNPKNSNSFVTASANHMIEICGSTRPSLRNPMFGVQVWDFDSPQCKYTLSGHWDRVNCL
DFFTHDNQQYLITGSSDCSAKVLITGLEDGTVYLWSSTNFRLERIINPPVIEPPAWGFGW
LYNIFSSPRLLHIFLKRVKWTYKCYPPQMFVFGRGETVAMVDVSNVNNQEESSHHSVPQI
RADTTTQLIDNSVLLEVHPSDLRFPLQPHKSTTCSLDLTNHTYERVAFRLVQKNKKSHSF
GEEEDSLLSNVPIYGFIASGSTYTLVVTTKEWPDQGEDTSLDLLLQSSISGDKFIVPFEN
ETECVDLFEELKEMGNVVHELTLKAVFYAQEEVTREIISATKKVDALGFGNSLVCLDAHP
TETWILTCKFFGDVHMWDLVSQACSVGLSATVKFLKFIARKRWFLAGADDGFIHVCTYGT
EIVQQIMSFRAGSSSVTAMTIHPTQPYVLSSAYESPIRLWNWEEGWQCTRTFDDEHSGTV
RQITFNPKDANCFASASEDQTVKVWNLDSPKSSYTLFGHLAQVNCLDFFAHGDQQYLISG
SDDLTARIWDLENRLPFAPLSLLSDRFIFSRLVRIIDLGCSKVRSVNLMGSVRVVIEQEG
AVSIMDIDPEQQGGIISEVGANMVDAARLDVAWEAQLDIFQEPKEDLPGAVSGTGNTNST
QASEECDGI
Download sequence
Identical sequences N1R3B6
EMT15610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]