SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT16343 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT16343
Domain Number 1 Region: 16-313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-65
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 336-486
Classification Level Classification E-value
Superfamily Mannose-binding lectins 3.92e-32
Family Mannose-binding lectins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT16343
Sequence length 714
Comment pep:novel supercontig:GCA_000347335.1:Scaffold38787:16130:21742:-1 gene:F775_24841 transcript:EMT16343 description:"Cysteine-rich receptor-like protein kinase 41 "
Sequence
MGDEAVLESILNGEMGPTHMPFALLERITENFSEERKIGQGGFALVYKGIYNGEDIAVKK
FYDVQTLDNKHFENECDKLIKIKHPNIVRLVGYCYETQHKYVEYKGVLQFAHHICRILCF
EYLQGGSLENHLNESRDHDWPTCYNIIEGTCEALNFLHKGYGSRVLHLDLKPGNILLDKY
MGAKVADFGLSTSFNKTRITNTTTGTEYYMAPEFKSKRVISPKNDVYSLGIIIIEIMAGR
IGYKIFSAMDDDPQELFIEQVITNWRGRINATTSPFPSAELDQVETCIKIAIKCVDLNRK
NRPTVAEILAAMQKTEKRFLAEWRNHAEFHVDESLPIPTKSESRGGSGGEVVDIKEHPWR
LHSLTISYQGLIDAFSFSYIDQYGEKQHVGPWGEQHSYHKTETIRFSPSEFVEEVSGAYG
SHFENLLVTSLTFVTNVRTYGPFGNPNHQNVAAAPLKFMADEGSSIVAFHGRSGSHLFSI
GVYMYPNNKRKGRTLLAPVIPDGEVLTDGGRGLRALRAFSLGACWDGCLHSTPAPPERTA
RQYADTTGGHFFFSRESYSEGELVEGGGKKVYQCGGTKLPPVPATREQRWLIAPNWDKGW
THACGLRRPNQSLVCFAGRTSRGGSRCPTFYRGLQEHKEDTAMVVEAECKRLLQNLRHEA
RMSKVKCRVKFLSKEKYMKARHNKKEVPPLFDVVTPRIRCTRRLPVIRRRCHVF
Download sequence
Identical sequences N1QXF6
EMT16343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]