SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT16994 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT16994
Domain Number 1 Region: 23-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-67
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 470-723
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-36
Family WD40-repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 311-414
Classification Level Classification E-value
Superfamily PapD-like 0.0000752
Family MSP-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT16994
Sequence length 733
Comment pep:novel supercontig:GCA_000347335.1:Scaffold36747:58571:65234:-1 gene:F775_23593 transcript:EMT16994 description:"Cysteine-rich receptor-like protein kinase 27 "
Sequence
MDNFQHSDLLALETALGEESRDPIAIPISVLKAITNNFSDAQEIGCGGFETVYKGTLGNG
MVVAVKKLHENVGVLSKNFNSEVDCLIEVKHKNIVQFLGYCSDTQKVLRSFQGKNVWAEE
RQKLLCFEYLSKGSLADYLTGPSCGLRWCTRYRIIRGICEGLHYLHHHHQPIIHLDLKPQ
NILLDDNMVAKIADFGLSRRLSARQSRILTKNIAGTPGYFAPEFINSGVITMKMDIYSLG
VLESWTDTFGSLQSHTLFEQVKVCAEIGINCINYNPENRPTIDDIIHRLEEMDLSNSSPG
SIASTSSTPLSGVNIYPLKLCFPFETEKRIDCPLSITNITDRYVNYWVVPQFPNMYTPCK
HELVNEIRTGTNNLDPMSTGSFNVTMLEQQQPPLDAGMFEIVMIAMGSRSDLKKLKSSIG
DEPKIDGELLKRVEEVGGEVHTAMLRAVISLPSEGGVAPKIVSGEEFMDLRSIDVHPTQP
WILVGHDKHLTIWDYKKQATVAALDVVGATMVYSVRFIPQRHWFVAGDDSGHIHVYSCVT
KKEVKRFQARDGDSSYVISLAIHPTCSYLLSACTDGVVKLWDWDSGWECIRTVHSTAGWM
QVKFNPKNTDTFTSCCTKGAMRMKSIYPSDEPIAGIDQYSSSLCDHAFTEGDQNHVVMLI
HGIGLQIWDLETKTHVHTLRGTKRLVRAPACHPKLPLIAVGIKEEDPEHAAVRFWNSTNY
RPVFLNLITKTLI
Download sequence
Identical sequences N1QZH0
EMT16994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]