SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17168 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17168
Domain Number 1 Region: 127-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-38
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 690-773
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000481
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT17168
Sequence length 910
Comment pep:novel supercontig:GCA_000347335.1:Scaffold36320:19225:24692:1 gene:F775_31280 transcript:EMT17168 description:"Auxin response factor 4 "
Sequence
MVSSSSFSFSCLMSRGFGGAGDPLYDELWHACAGPLVTVPRVGDMVYYFPQGHIEQVEAS
MNQVAANQMRLYDLPSKLLCRVLNVELKAEADTDEVYAQVMLMPEPEQSETTTEKSSPAT
GGATPARPAVRSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMTQSPPTQELVAKDLHG
MEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGESGELRVGVRRAMRQLSN
IASSVISSHSMHLGVLATAWHAINTKTMFTVYYKPRTSRSEFIIPYDKYMESVKNIYSIG
TRFKMRFEGEEAPEQRFTGTIVGSDNLDQLWPESSWRSLKVRWDESSTIPRPDRVSPWEI
EPASSPPVNPLPISRPKRSRPNVPPASPESSVRTKEGATKADMDCAQAQRNQNNTALPGQ
EQRSNKLTDINDFDASVQKPMMWSPPPPPNIGKNNPLTFQQRPSVHNSFQLGRRETDFKD
ASSGAQPFGDSLGFFMQTTFDEAPNRLSSFKNQFQDHSYARQYADPYLFMHQQPSLTVES
SRKMHTENNEMHFWNGPSTAYSNSRDQAQDFRFTEHPSNWLSPQFFRAEQPRVIRPHASI
APIELEKTTEGSDFKIFGFKVDTASAGFNHLNSPMAGTHEPVLQTQPSVSLDHLQTDCSP
EVSLSIAGTTENEKNMQQCPQSSKDVQSKSHGASTRSCTKVHKQGVALGRSVDLSKFVDY
DELTAELDKMFEFDGELLSSNKNWQIVYTDNEGDMMLVGDDPWEEFCSIVRKICIYTKEE
VQKMNSKPSGPKKEEGSVDGDGATEKAHLPASSDLNSSQLVDIATSILYFSYFYVLKYEE
EEGETEPALPVAEAGFGMPDALGKFKVAQAEQALEQQTILDSIRLEAEVEANRRYIHQQR
AETDAIFTDM
Download sequence
Identical sequences N1QYI4
EMT17168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]