SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17190 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17190
Domain Number 1 Region: 289-525
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.7e-50
Family WD40-repeat 0.0005
Further Details:      
 
Domain Number 2 Region: 144-246
Classification Level Classification E-value
Superfamily PapD-like 0.0000000419
Family MSP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT17190
Sequence length 553
Comment pep:novel supercontig:GCA_000347335.1:Scaffold36272:39296:45780:-1 gene:F775_24426 transcript:EMT17190 description:""
Sequence
METRSAPVSSLRCRKFAGSRRALLCPAHNPTLPIYSYKRRTWTLSPSSSVNFLVNPTIFN
TSTIHRSLTFKQRCDHIVGLKKQFRMYHVIDWVNRYMEHSGLESMHAGREKASNLPCASL
ENIMEDSSYERINSQGVSRHVYKVITGSCEALDVHPLELRFPLDYNTLILCPLHLTNNTD
EQVAFKLMPKRGIYSCFRNIPLYGVVPQRSSYTLIVIMTPPAKRSEDTDFDLILQSIKFG
EGIIQGQCNDRSFEAAKEVGTGMHEVTLKAVSAPQGETIYKHTIPPVMKVISVERARQEL
YSIDANPEKSWIIIGHSGGYVRIWDYVTQQWFVAGSSDGIHVQEEAIKKKKIQRFRARVS
SVTSLAVHPTKPYVVSSSYGGLIKLWDWDKGWECITTFEGEHSDVVCQLAFNPNDTNSFA
SVSNDRTIKVWGLDSPKSHYTLSGHSDNVKCLDFFTRDDGQYLITGSVDNTAKIWDLQKK
TCILTLEVFRSPVIYVFSHPNLPVLITGTRNGIIYLWSSTDFRVVIGQSHAISIVDIDDE
ETIGGKGDNESSI
Download sequence
Identical sequences R7WCB0
EMT17190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]