SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17385 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17385
Domain Number 1 Region: 187-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 7-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-16
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT17385
Sequence length 298
Comment pep:novel supercontig:GCA_000347335.1:Scaffold35727:5932:7882:-1 gene:F775_31760 transcript:EMT17385 description:"B3 domain-containing protein "
Sequence
MQTSEGLDLKLKAPSGETWHVGVSKVANELFLRSGWGGFAKAHELQENDLLLFTCTGNAS
FEVLIFDPSGCEKLSPLFAGRMRKHFDNMVGQGGVEQYPDSDDTRVPSQFVGSPQKASTS
RKCSGKTKSSKELPESPSSTSCHVKLEATEEQKSDDDTCTEPGYYSSRTASQLNEDEKQE
IMERASIRPGNPAFVVVLLMTHLQRKNNFLTIPSKFAADHLQSKPREVLLLRLSREDKWH
VRCYYSSRTRCFNCQRWVKFVRDNGLREGDVCVFELIKGARKMTTMTVHVARRKKDGR
Download sequence
Identical sequences N1R017
EMT17385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]