SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17386 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17386
Domain Number 1 Region: 228-328
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-18
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 378-478
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-16
Family B3 DNA binding domain 0.0068
Further Details:      
 
Domain Number 3 Region: 106-175
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000235
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT17386
Sequence length 480
Comment pep:novel supercontig:GCA_000347335.1:Scaffold35727:18943:21788:-1 gene:F775_23599 transcript:EMT17386 description:"B3 domain-containing protein "
Sequence
MHPVAVEISSYEELLANRYTPNHVLQTILEYPLGVLIVAYLRGIRAANIENQVANYQLDQ
DNLVPTPLDIYHSILEALVDQRCLLHFCLQSSPLCLECVDRHYWHMKDHDWCFVKVMSLS
NFKDEMAIPDEFTTNFRGHISDKVKLEVADGNIYNVQVAKEQDKFILRSGWVDFTAQDVT
SSKYIPEPRSSGGLPGSTESRYILEKGCILTSAQKARVDTFVKESWTGIQFYVTVMNEKS
LSDGCLVICKDFAAKHLPHKDQTIKLCYPQNSKTWDANLAVITDGACTRSCILAAGWLDF
VRDNNLREGDICAFEVSKDHDRVIITVHLLKNVVVTGHTKSTSQQQKKWTHPGYVVTKYT
KLTCKQKRKIEERIQAIRPETRIFVSIIYSSRAKLSIEVRYATAHLPREEQWVRLQLPGK
NHTWKAKLYIGDKDKGKCYALQTGWKKFVDDNKLQDDDMCLFELLKNEELTMNVHIIRGD
Download sequence
Identical sequences N1R3W8
EMT17386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]