SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17387 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17387
Domain Number 1 Region: 197-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-22
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 48-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-17
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT17387
Sequence length 294
Comment pep:novel supercontig:GCA_000347335.1:Scaffold35727:25125:27763:-1 gene:F775_00498 transcript:EMT17387 description:"B3 domain-containing protein "
Sequence
MPYGGTRRSARVDPAWSGGCGQRMQTSLARCNECVVYHNWHCKGDWKKRFVKIVTGDFVD
VPRKFLVNNMRGQIPDEVNLDLPNGKAYTVQVSKQENGLIFQSGWAEFARTYELVQGDIL
LFESSGSSCFEVRIFNQTGCEKELSCVAMKNTPCLNEKSMPHDNDMQSPKNERCGNMSGK
SHTICKVCAAFYYWHHMDKMRFFMVMMGVRASKNELTIPKEFANNVRGKISDEIKLEVPD
GQTYRVQVDKEPNEVVLRSGWDAFVSAYELKEGDTLLFAYTGNSHLKVQIFNDK
Download sequence
Identical sequences N1R0L0
EMT17387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]