SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17392 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17392
Domain Number 1 Region: 157-300
Classification Level Classification E-value
Superfamily Mannose-binding lectins 6.02e-39
Family Mannose-binding lectins 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT17392
Sequence length 301
Comment pep:novel supercontig:GCA_000347335.1:Scaffold35711:109316:110597:1 gene:F775_17960 transcript:EMT17392 description:""
Sequence
MAATNPSYYQSGACQEIRHKEHLFHLYMNQVFDGKLVTNANQLAIVTPGLPNSFGVTIAN
DWTILDGLGADANLVARARGMHMGVGKADMSWLFCHTILFADTSRFKGSSLKVLGDFVGD
KDSEWAIVVYKYGDLDLRKCTFSISLFLCRLITYAQTPVTKMGPWGADGGTAFDITELPR
SLQTVTIRCGDVINSIGFSYTDQAGQKKIAGPWGGDGALSVTITLAPSEFIKQVQGTTGV
VGGVTVVTSLTLVSSVTTYGPFGKANGTPFSSQVPDSNSIGGFYARAGGSFNALGVYACP
I
Download sequence
Identical sequences R7W6Z7
EMT17392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]