SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT17818 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT17818
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily Mannose-binding lectins 7.06e-32
Family Mannose-binding lectins 0.0000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT17818
Sequence length 134
Comment pep:novel supercontig:GCA_000347335.1:Scaffold34567:10123:10909:1 gene:F775_04915 transcript:EMT17818 description:"Uncharacterized protein "
Sequence
MVASKKLMKVGPWGGTGGNPWDDGGHTGIRGVTLSYDHRCVVSIAVEYDRSGLAVPGERH
GGAGGNHTTQIKLSFPDEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAAEGTP
FEFALVYMKPEIYA
Download sequence
Identical sequences N1R0J3
EMT17818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]