SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18010 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EMT18010
Domain Number - Region: 112-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00294
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT18010
Sequence length 164
Comment pep:novel supercontig:GCA_000347335.1:Scaffold34147:19028:19522:1 gene:F775_09083 transcript:EMT18010 description:""
Sequence
MECLDCKNPYAVCRDVEGPSCHISVPMTTFYWFESVRPSHHDVALLLFNLDKLPCFWSHH
LRFVPCCNRQVLGAYIEHVQSVATKENKPVGNPIFATRELLEYEVMIDHGDKRTRIHEIG
WQRFLDEYAVRLGDMVYICLPRGNGRFFVEVERGGIRQLPLPCQ
Download sequence
Identical sequences R7WDK7
EMT18010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]