SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18128 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18128
Domain Number 1 Region: 203-349
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.96e-21
Family Mannose-binding lectins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT18128
Sequence length 350
Comment pep:novel supercontig:GCA_000347335.1:Scaffold33815:38165:40533:-1 gene:F775_02135 transcript:EMT18128 description:"Uncharacterized protein "
Sequence
MATPTEEPTMETCGDDVSDPSMETIGVLSDVSMVNRSLPVGVVSPNFKVTRGFGGIAENA
KVNVDRLYLRQILTGWDANQSDVIQPNAVTGLGKTAVNNWGVYDGAGSKAKLVAKTHGMH
TLAGKWSNWFTLAFVVGRFEGSTLQVMGANDEDVADNDWAIVGGTGEFAMARGIIQRRVY
SITNSTLTHALTIEFFCHMKEVVPSPTKRGTVGGNRGTLPREMEGKSQRLENVTIYHVGA
VEGFQFSYVDEDGKIRTTDTWGRVHPDPLRKTEIKFGPSEFVKKINGAQRGGEGWLSKFE
IVTTHKTYGPFGADNGTPNFSYTVPEDETVVGFFANTDNIFVTSIGVYTI
Download sequence
Identical sequences N1R141 W5I5Y4
XP_020179470.1.58150 EMT18128 Traes_7DS_26341EE29.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]