SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18170 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18170
Domain Number 1 Region: 400-500
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-18
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 2 Region: 58-152
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-16
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 237-341
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000353
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number 4 Region: 582-684
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000353
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT18170
Sequence length 685
Comment pep:novel supercontig:GCA_000347335.1:Scaffold33696:36234:40124:-1 gene:F775_11123 transcript:EMT18170 description:""
Sequence
MAHTSLVFFSALPPPWQHVHVDMPSAPRRRAGPAGVRSAGAGGKAPVVMSNPCECSRRRA
KFIMQMRGNFKHSMVIPERLVDHFGGKISGTIQLEAPNGQMYVVGVAKKMNRSVLQSGWE
AFVHANQIQDNSYLMFRNLGISCFKVTIFDSNGEERISCRAGAKISTHVEKASTYRADIS
SSSFDGASDSEAEDSLSEGESMESDDLQGLSKDYVLAGRCHLTEEQEDEIKGFVAKIQPE
TPVLVVMMKKTNVNHYPNLVISKDYAHAYFPHKTQFVTLKLPGKSKAWPCKFRIRPDGRG
RNLSLREFVHDNRVKKGDLCLFQPMTEVQSTRFTFMVHLLRKVGRTDICSNQGEDSPSEY
ESIQSDHQETSSEVRYILSRRCRLDEEDEVGIDALIAEIQPEIPLLVVQIMKSNVSGPQP
ALVIPKRYAAAHFPTESQNIVLTLPGVKKKWHPLFHVRRGNIGYVLYGRWLEFVRDNRLR
EGDICLLQPINRGEGRRFMLTVHLLPKARRAGKSKGGDVVRGSKIGGTSTKAASTACVKD
EPVDGASDGCDRAGYVVLGCSARLTQEQEKVVAEKVKAVRSRAPIYVAAMDKSNLSSALD
LRTTGHAAADGHLLPDGKQTLTLREAGWSKAWRVEMRHRRMVPAGGWREFAADNRLQAGD
LCLLEPVADKRLAMAVHIIRREQCR
Download sequence
Identical sequences R7WDS4
EMT18170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]