SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18234 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18234
Domain Number 1 Region: 73-145
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000275
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT18234
Sequence length 234
Comment pep:novel supercontig:GCA_000347335.1:Scaffold33494:17673:18426:1 gene:F775_43055 transcript:EMT18234 description:""
Sequence
MNGRIDAAEEARHRQVMDCLGVYDADWALSRVLEQSDVQAGQNRLLFTEEAVRGGFIPEV
FLELEELRDDSLNAENRVLVKVLDAEGREKEVSLPYLNSSKVYRVIGFDWRRLVEENRMC
KGDRLDFYTCRRGDGDRCLFVFRSKGGGGSSWWNRMNGAMDSRCCIDPAEEARHRQAVMD
GLGVYDAEWALSKAVRANPIPELFPELEELRDDGLNARNTVAVTVLDAEGREKE
Download sequence
Identical sequences R7WES8
EMT18234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]