SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18442 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18442
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.62e-54
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 292-420
Classification Level Classification E-value
Superfamily PapD-like 9.42e-22
Family MSP-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT18442
Sequence length 424
Comment pep:novel supercontig:GCA_000347335.1:Scaffold32827:17979:19709:1 gene:F775_12150 transcript:EMT18442 description:"Cysteine-rich receptor-like protein kinase 41 "
Sequence
MYNGDEIAVKKLHHLVGLDDKAFDSEFRNLSKVQHQNIIRLIGYCYESRHQYVQLNGELV
FAKEMERVLCFEFMEGGSLDHHIADDSCGLEWPTCYEIIKGTCEGLNHLHNSQGKPILHL
DLKPANILLDKNKTAKIADLGLSRLVASTQTHKTEVVKGSQGYMPPEYIDDNLISMKFDV
FSLGVIIIKIMDGNMGRSRCSEMGSEPFIEFVCKKWMTKLRAKSGYSSDEIDRKCMKKCV
EIALRCVVSDRNKRPLIKDIVKELEELEDEIKKMSTSSVQLEELIARQRGCDSNVLAVDP
TLELRFLFEPRKDISSCLQLTNMTSGFTAFNVKTNHTKYRTQPSKGVMPPCSKRYISVTL
VAQDEAPQNMQCNDMFLVQTACVGANLTSDEMITEDLFKEAMAEKVMDVVKLPIVYVSLD
QFQC
Download sequence
Identical sequences N1R175
EMT18442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]