SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18693 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18693
Domain Number 1 Region: 282-381
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000902
Family B3 DNA binding domain 0.0079
Further Details:      
 
Weak hits

Sequence:  EMT18693
Domain Number - Region: 157-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0804
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT18693
Sequence length 395
Comment pep:novel supercontig:GCA_000347335.1:Scaffold32125:44938:48386:-1 gene:F775_22319 transcript:EMT18693 description:""
Sequence
MAATGPALGAGMRSWSEVRRQATAALASTHAARPRLRGEPAKPFLFARSDPKLTYERWAI
LARSAREWSSSEEITFVYAHKTMKSDDLPQEGPGHDNFLLGRPDIVPIQGHGSLLEYESV
EPEDGQSPPETDCGLILRGCLSGAQSERLNALIQKVKPETVVFVAVMKNSDVQSPRPLLI
ISKERTLVEAAQFPHENGMPVTLQIPDKSEKWHPRFYMEKGEGMLAGGNVSPESDIHGFP
HDSLDGKDTHSSEQPSLILPWRTSLTTTQRKIVDEKCQAIGSKYRLYVATLNSSSLQKKQ
FEFGQDYAHAVHLPAKTTDVILKSNGKDWETKMSCRKGNNNSNRWMLVSGWGDFMRGNEV
REGGLVDGDMLLFELKSMNEKEITMEVHVVPRENL
Download sequence
Identical sequences R7WAM2
EMT18693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]