SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT18893 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT18893
Domain Number 1 Region: 664-808
Classification Level Classification E-value
Superfamily Mannose-binding lectins 2.62e-40
Family Mannose-binding lectins 0.00017
Further Details:      
 
Domain Number 2 Region: 17-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-30
Family Extended AAA-ATPase domain 0.09
Further Details:      
 
Domain Number 3 Region: 232-619
Classification Level Classification E-value
Superfamily L domain-like 1.46e-23
Family Leucine rich effector protein YopM 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT18893
Sequence length 809
Comment pep:novel supercontig:GCA_000347335.1:Scaffold31493:222161:225226:1 gene:F775_06654 transcript:EMT18893 description:""
Sequence
MAWLCELAPVHTTCLMKCLRQFFQYLILIDDIWDEKPWKLIKCVLAENKLGNKVIMTTRN
VDVARSCCSSDKVDGIVHELQPLSDCDSEQLFYYKIFGNYGCPAELKVVSQKILEKCEGW
PLGIIAIASLLANKPTQTKDQWCSVYNSISTGLENNHGVKDMRLILSLSYRDMPLQLRAC
LLYLSIFPEDQIIGRDDLIRRWIAEDLVRGRQDDNLYELGDKYFNELINRSMIQPTDVDA
FGRAQACKVHDLVLEFITFLSAEEDFVTILNGQQPFPPQPDSIHRLSLRNSKGEHGIPQA
TKRLPHVRTLFVSSRANSMPPLSIFPVLRVLELEQCTRRNIRGVEILVHLRYLRLSQAYH
YYYDVCIKLPEEIGNLQFLQTLDLKEARIKELPSTVVHLRQVRVLEISLRKWDKRCEERL
LQCLCNLKQLEALYIFAPDYSLDFMLRVDWAPSHLRRFTVCARQNEENASLTAFVHWLAF
SPFSTLPKWINSSLSHLSNLSIVVKILLQEDILSLGCLPALCSLYLQVIEAPTKERLEIT
ERTGGHAIAFCCLVNFRFMSRAMGLVFRPGAMKGLQRLSLTFDVAETKDVYVDFNLGLEN
LTSLQALDVELDCRCATTSEVQAAEDATYLNARHPTFHVSRHFTEDMRCDQEEEIPELET
MRAGLARIGPCGEGGGRACDIKVVPQRLESVTIYSGSLVESLVFSYRDHDGKRHTAGPWG
SHPGENNDVIHLEPSEILKEVSGTVGSYGALTNVITSLTLVTSARTYGPFGKGDGIPFSM
EAASNSSIIGFFGRSGWYLDAIGVYTRPL
Download sequence
Identical sequences R7WB18
EMT18893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]