SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT19150 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT19150
Domain Number 1 Region: 33-170
Classification Level Classification E-value
Superfamily PapD-like 1.49e-34
Family MSP-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT19150
Sequence length 229
Comment pep:novel supercontig:GCA_000347335.1:Scaffold30865:12755:14657:1 gene:F775_29930 transcript:EMT19150 description:""
Sequence
MPLWGTASGPPPPLAEGGGAEGSGGSSGAAAIRSLLPTRRRLRLDPPSKLYFPYEPGKQV
RSAVRIKNVSKSHVAFKFQTTAPKSCFMRPPGGILAPGETIIATVFKFVEHPENNEKPLD
QKCKVKFKIVSLKVKGPVEYVPELFDEQKDQVAVEQILRVIFLDAERPSAQLDRLKRQLA
EAEAALEARKKPPEDTSPPIVGEGLVIDEWKERRERYLARQQVEEVDSV
Download sequence
Identical sequences A0A1D6CUL1 R7WEQ7
XP_020148498.1.58150 EMT19150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]