SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT19609 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT19609
Domain Number 1 Region: 112-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-42
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 1032-1096
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000304
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT19609
Sequence length 1151
Comment pep:novel supercontig:GCA_000347335.1:Scaffold29940:200668:208412:-1 gene:F775_07729 transcript:EMT19609 description:""
Sequence
MGFRCVFSGEKKAPAINSDLWHACAGPLVQLPPAGSLVVYFPQGHSEQVAASMQKDVDAH
VPNYPNLPSKLICLLHNITLHADLETDEVYAQMTLQPVTSYGKEALQLSELALKQARPQN
EFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIQARDLHDNVWTFRHIYR
GQPKRHLLTTGWSLFVSGKRLFAGDSVIFVRDERQQLLLGIRRANRQPTNISSSVLSSDS
MHIGILAAAAHAAANNSPFTIFYNPRASPTEFVIPFAKYQKAVYGNQLSLGMRFRMMFET
EELGTRRYMGTITGINDLDPVRWKNSQWRNLQVGWDESAAGERRNRVSIWEIEPVAAPFF
ICPPPFFGAKRPRQLDDESSEMENLLKRAMPWLGEEICIKDPQTQNTIMPGLSLVQWMNM
NMQQSSSFANTAMQSEYLRSITNPSMQNIGSGDLSRQLCLQNQLLQQNNMQFNTPKLPQQ
MQPNNELSKAALPLNQNGASIKPEEQTQDASNFQRQQQSMNYALPLSQAQTNLAQAQVLI
QSQMQQQQQQPHISQNQLPAVSQPLLSHQQQQHHHQQQQQQHQQQEQQHQQQQQQQKFLQ
QQQLLLQQQQLQQHQHQLQQQQQQQLGKMPAQLPNLSNQQLQLSDQQLQLQLLQKLQQQQ
QSLLSQPGVTLAQLPLIQEQQKLLMDMQQQLSSSHSLSQQQMMPQQSTKIPSQVASLPPP
MQPDTTHQKLPQKQALPADTLEAAIPTTTSHKFSSANGSPLRMPGATHSVVTEEIPSCST
SPSTANGNHLLQPVPGRDQYSSMINTEKAPHSTAPMSVPSSLDAVTGAQRMTKELPKLNS
NVKQNMMPSKLPNGGAGPQNFANNAPPTDYLETASSATSVWLSQADGLLHPNFPMTNFSQ
QQLFKDAPPDTEIPAEIPSNNALFGISNDGHVGFPMVTDDFLTNGIDAVKYENHISTDID
NNYRIPKDAQQEISSSMVSQSFGASDMAFNSIDSGINDGAFLNKSSWPPAPPVKRMRTFT
KVYKRGAVGRSIDISQYAGYEELKHALARMFSIEGQLEERQRIGWKLVYRDHEDDILLLG
DDPWEEFVNCVKCIRILSPQEVQQMSLDGDLGSSVVPNQACSSSEGGGNAWRARCDQNSG
NPSTGSYDQFE
Download sequence
Identical sequences R7WG30
EMT19609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]