SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT19908 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT19908
Domain Number 1 Region: 76-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-23
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 280-382
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-19
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT19908
Sequence length 388
Comment pep:novel supercontig:GCA_000347335.1:Scaffold29204:56758:59763:-1 gene:F775_23597 transcript:EMT19908 description:""
Sequence
MPLGPAVVDVSDATPHLLHEHHMLPLVPSPPHAFPLHSQPSPKAPDDTFRKEMSKPWMKH
KELDEHRYRNHTGEQDKNFFKVMIGDFHERMIIPDKFAQHFRGQIGRTIKLASRHGYTSD
VQITKNLAKLVLDSGWKAFARAHNLRTGDFLVFKYDGNSELKVLIFGPSGCEKLPVCNLM
KNAAPGKDWWGNTDDIVNTCHDPPMKFPHCGRQIRPSMDSSRQGNDIINVSSSSSASDSA
GGISSSEDDLSLPGCILANGTLLNLNQVQKKQLKEKVRAMNSEVPIYGCVIRKSSIYGAT
RSLDISRKYAEVYLPFKEQMLTLQLHGKKWEVRCRVKNNKTKRLMRGWKHFARGNSLWLG
DVCLFELLRNKKKYVMNLHIIRKSLYKR
Download sequence
Identical sequences R7WD09
EMT19908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]