SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT19909 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT19909
Domain Number 1 Region: 21-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-24
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 228-332
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-20
Family B3 DNA binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT19909
Sequence length 336
Comment pep:novel supercontig:GCA_000347335.1:Scaffold29204:70488:72113:-1 gene:F775_23598 transcript:EMT19909 description:""
Sequence
MSKPWKKRKDLDEHCYWNHTDEQDKRFFKVMIGDFHERMIIPDRFVQHFRGQTGRTIKLV
SRHGYTFDVQITKNLEKLVLDSGWKAFARAHNLRTGDFLVFKYDGNSELKVLIFGPSGCE
KIPVCNLKKNAAPGKEWWGNSAGIVNTCHNLPMKFPHSGRQIRPSKDTLRQGNDIINVSS
SSSASDSAGGISSSEDDHSLPGCILANGTLSNLNQVQKNQLKEKIRAMNSEIPIYGCAIR
KSSIYGKTRTLEISRKYAEVYLPFEEQMLTLQHHGKKWEVRCSVKKSKGKRLLTGWKHFA
CGNNLQLGDVCLFELLRNKKKYAMNVYIIRKSLYKR
Download sequence
Identical sequences R7WGA5
EMT19909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]