SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20130 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20130
Domain Number 1 Region: 101-199
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-22
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT20130
Sequence length 215
Comment pep:novel supercontig:GCA_000347335.1:Scaffold28563:21805:23394:1 gene:F775_05089 transcript:EMT20130 description:""
Sequence
MEESNSYEEQRRRQIEENRRKLDELRLHHLSAAVREAAARPKPNPNPKPRPPNYLKGAQQ
RDDQGVYAAYDARIWKGPTDEERAAAVAKAEELQRRIHRIRRPAFVKTMTHVCASRAKQM
MIPKHFIEHLPAHDEAVVLVDQADDEFHMMCNASKEGRHCYLSKGWREFAVHHDLENGDC
LVFQLIDSAKFKVYIFRANPDYESDQTSDDSEDEQ
Download sequence
Identical sequences R7WFN7
EMT20130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]