SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20151 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20151
Domain Number 1 Region: 340-438
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000981
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 47-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000373
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 3 Region: 202-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000392
Family B3 DNA binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT20151
Sequence length 440
Comment pep:novel supercontig:GCA_000347335.1:Scaffold28527:56197:59020:1 gene:F775_00499 transcript:EMT20151 description:"B3 domain-containing protein "
Sequence
MTVDGVNEGCGEGCDVEGCECGADGCEECEWWRLHCYWSHAGDRPRHFSLVAGDDFADHM
RIRPPVASHLRNLITEFDKIQLEAPNGRSYPVKIGWEFGDIVLRSGWHDFVEAHHIEQNY
SIRFVYRGNSSFEVHISGSSGHDNSSPPPPRDRHVLNEQVVPDPAHVQTSINIDYTAFPG
TRLSHEQEKKVLELAQSSMRSEFRLHVAAVNKRNANGDCHVYIPLTLLDSFKEGITEAPI
QLKAHSNDMIYVVGASKHGDDQVILQSGLSHFVDGHRMQDNDLLVFRSKGKARLEVLVLD
PSGCEKTWFDMGNSSNVSREGRRAQAQNMASTSFGWAKSVITSSDVATAPSLYLGKDYAS
ACLLTQPGRLRLLLEGDERDWDCRLGLRKSNKTWWIDRSWPKFISDVGLEEDDICLFELT
DRSSLTMKVHVIRKSDIPAP
Download sequence
Identical sequences N1R1B0
EMT20151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]