SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT20365 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20365
Domain Number 1 Region: 285-384
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-20
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 491-587
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-17
Family B3 DNA binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 138-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-16
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 4 Region: 652-756
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-16
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT20365
Sequence length 766
Comment pep:novel supercontig:GCA_000347335.1:Scaffold27867:7788:11724:1 gene:F775_00577 transcript:EMT20365 description:""
Sequence
MYALLLWAWASLAFWLLLCRSTGSWQRLLFFSGLGAASLQKYWLVQRASGQRLLYLTFVM
APDQYHEQGNRSGHNISSKSFQRCEGCEAHYYWCHMDDTQKYFFKCMVGNFHDKMASPGA
SMPFLSFRWNSIPVQNDNVVVCLFMQTIPQKFVENFKGQISEVIKIEAPDGNIFNVQATK
NLDKIVLGSGWGVFISFYEVKEGNFLVFRYMGDSHFKVLIFDFGSCCEKEVFHVLVNCGS
NAQEKDIHLDQSPLSERRCQNGGSSNSGSHRRCEHCDVHFYWHHMDDRQKHFLRLMFGDF
RQEISIPEKFVNNFRGRISKVMKLEAPDGNVYNIQVINDLNKIVLRSGWAAFASAYELKE
HDLLVFRYIGDSHFKVLIFNPSGCEKEVFHIVMNHTPNLPEAGISHDRSFLKETRHRDCE
SRDNNSRKTKKMTPLYSPSLRSAEGVTSPEDTLNSGGLRETTKPRYVLAMGCNLTTVQKA
EVNALVRKVRPAIPFYITAMNKTSMSGSLVICKDYAAKYLPDEDQFITLCHPHKSNIWID
NLKVITDGSRMLSVGWSCFVLHNELRESDICLFEVSKNDGEVTMVVHSLEGAHHLQGKEL
ESQKKRRYPVKAEATEDEESDKEHVESNYYYSRHANGLTSDEQEDIFRSELIQQGNPVYI
ALLGKNHLKKRNNLLTISRKFAAKHLAARSHDILLLRHNRGKKWCVRYYYHSIFRGFCNS
PWTKFVHDNKLREGHICVFELIKGVPKAMMIVHVFRKVDGRLALLD
Download sequence
Identical sequences R7WFW4
EMT20365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]